Specification
Organism | Escherichia coli (strain K12) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprot ID | P69506 |
Uniprot Entry Name | |
Gene Names | YTFE |
Alternative Names | Regulator of cell morphogenesis and NO signaling |
Expression Region | Full Length (1-220aa) |
Molecular Weight | 51.9 kD |
Endotoxin | Not test. |
Sequence | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
Product Form | Liquid or Lyophilized powder (If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.) |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
Relevance | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. |
Function | |
Involvement in disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | |
Pathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |