Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

Specification
Organism Escherichia coli
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06717
Gene Names eltA
Alternative Names LT-A, porcine LTP-A
Expression Region Full Length of Mature Protein(19-258aa )
Molecular Weight 45.3 kDa
Protein Sequence NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Involvement in Disease
Subcellular Location
Protein Families Enterotoxin A family
Tissue Specificity eltA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PELa33569348

Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)
Copyright © 2021-present Echo Biosystems. All rights reserved.