Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P52061 |
| Gene Names | rdgB |
| Alternative Names | Deoxyribonucleoside triphosphate pyrophosphohydrolase1 Inosine triphosphate pyrophosphatase1 Short name: ITPase1 Non-canonical purine NTP pyrophosphataseUniRule annotation1 Non-standard purine NTP pyrophosphataseUniRule annotation1 Nucleoside-triphosphate diphosphataseUniRule annotation1 Nucleoside-triphosphate pyrophosphataseUniRule annotation1 Short name: NTPase yggV |
| Expression Region | Full Length(1-197aa ) |
| Molecular Weight | 41 kDa |
| Protein Sequence | MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Can also efficiently hydrolyze 2'-deoxy-N-6-hydroxylaminopurine triphosphate (dHAPTP). Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.To a much lesser extent,is also able to hydrolyze GTP, dGTP and dUTP, but shows very low activity toward the canonical nucleotides dATP, dCTP and dTTP and toward 8-oxo-dGTP, purine deoxyribose triphosphate, 2-aminopurine deoxyribose triphosphate and 2,6-diaminopurine deoxyribose triphosphate |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | HAM1 NTPase family |
| Tissue Specificity | rdgB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |