Specification
| Organism | Escherichia coli |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q46668 |
| Gene Names | cdtA |
| Alternative Names | Cytolethal distending toxin subunit A(CDT A) |
| Expression Region | Full Length of Mature Protein(22-258aa ) |
| Molecular Weight | 29.5 kDa |
| Protein Sequence | CSSGKNKAYLDPKVFPPQVEGGPTVPSPDEPGLPLPGPGPALPTNGAIPIPEPGTAPAVSLMNMDGSVLTMWSRGAGSSLWAYYIGDSNSFGELRNWQIMPGTRPNTIQFRNVDVGTCMTSFPGFKGGVQLSTAPCKFGPERFDFQPMATRNGNYQLKSLSTGLCIRANFLGRTPSSPYATTLTMERCPSSGEKNFEFMWSISEPLRPALATIAKPEIRPFPPQPIEPDEHSTGGEQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | cdtA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |