Recombinant Escherichia coli Chorismate pyruvate-lyase(ubiC)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P26602
Gene Names ubiC
Alternative Names CL (CPL)
Expression Region Full Length of Mature Protein(2-165aa )
Molecular Weight 19.5 kDa
Protein Sequence SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate for the ubiquinone pathway.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ubiC
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEENV338889

Recombinant Escherichia coli Chorismate pyruvate-lyase(ubiC)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Chorismate pyruvate-lyase(ubiC)
Copyright © 2021-present Echo Biosystems. All rights reserved.