Recombinant Escherichia coli 30S ribosomal protein S8(rpsH)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0A7W7
Gene Names rpsH
Alternative Names rpsH; b3306; JW3268; 30S ribosomal protein S8; Small ribosomal subunit protein uS8
Expression Region Full Length of Mature Protein(2-130aa )
Molecular Weight 18 kDa
Protein Sequence SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assbly of the platform of the 30S subunit.Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.
Involvement in Disease
Subcellular Location
Protein Families Universal ribosomal protein uS8 family
Tissue Specificity rpsH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PR4Ba85999

Recombinant Escherichia coli 30S ribosomal protein S8(rpsH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli 30S ribosomal protein S8(rpsH)
Copyright © 2021-present Echo Biosystems. All rights reserved.