Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P02358 |
| Gene Names | rpsF |
| Alternative Names | rpsF; b4200; JW4158; 30S ribosomal protein S6; Small ribosomal subunit protein bS6) [Cleaved into: 30S ribosomal protein S6; fully modified isoform; 30S ribosomal protein S6; non-modified isoform] |
| Expression Region | Partial(1-131aa ) |
| Molecular Weight | 42.2 kDa |
| Protein Sequence | MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds together with S18 to 16S ribosomal RNA. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Bacterial ribosomal protein bS6 family |
| Tissue Specificity | rpsF |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |