Recombinant Escherichia coli 30S ribosomal protein S21(rpsU)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P68679
Gene Names rpsU
Alternative Names rpsU; b3065; JW303730S ribosomal protein S21; Small ribosomal subunit protein bS21
Expression Region Full Length of Mature Protein(2-71aa )
Molecular Weight 35.4 kDa
Protein Sequence PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families Bacterial ribosomal protein bS21 family
Tissue Specificity rpsU
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PR4Ba86669

Recombinant Escherichia coli 30S ribosomal protein S21(rpsU)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli 30S ribosomal protein S21(rpsU)
Copyright © 2021-present Echo Biosystems. All rights reserved.