Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0A7U3 |
| Gene Names | rpsS |
| Alternative Names | rpsS; b3316; JW3278; 30S ribosomal protein S19; Small ribosomal subunit protein uS19 |
| Expression Region | Full Length of Mature Protein(2-92aa ) |
| Molecular Weight | 14.3 kDa |
| Protein Sequence | PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | In the E.coli 70S ribosome in the initiation state it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states , contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Universal ribosomal protein uS19 family |
| Tissue Specificity | rpsS |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |