Recombinant Escherichia coli 30S ribosomal protein S18(rpsR)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0A7T7
Gene Names rpsR
Alternative Names rpsR; b4202; JW4160; 30S ribosomal protein S18; Small ribosomal subunit protein bS18
Expression Region Full Length of Mature Protein(2-75aa )
Molecular Weight 35.9 kDa
Protein Sequence ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.
Involvement in Disease
Subcellular Location
Protein Families Bacterial ribosomal protein bS18 family
Tissue Specificity rpsR
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PR4Ba86969

Recombinant Escherichia coli 30S ribosomal protein S18(rpsR)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli 30S ribosomal protein S18(rpsR)
Copyright © 2021-present Echo Biosystems. All rights reserved.