Recombinant Escherichia coli 30S ribosomal protein S15(rpsO)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0ADZ4
Gene Names rpsO
Alternative Names rpsO; secC; b3165; JW3134; 30S ribosomal protein S15; Small ribosomal subunit protein uS15
Expression Region Full Length of Mature Protein(2-89aa )
Molecular Weight 14.1 kDa
Protein Sequence SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assbly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations.
Involvement in Disease
Subcellular Location
Protein Families Universal ribosomal protein uS15 family
Tissue Specificity rpsO
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PR4Ba87299

Recombinant Escherichia coli 30S ribosomal protein S15(rpsO)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli 30S ribosomal protein S15(rpsO)
Copyright © 2021-present Echo Biosystems. All rights reserved.