Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0ADZ4 |
| Gene Names | rpsO |
| Alternative Names | rpsO; secC; b3165; JW3134; 30S ribosomal protein S15; Small ribosomal subunit protein uS15 |
| Expression Region | Full Length of Mature Protein(2-89aa ) |
| Molecular Weight | 14.1 kDa |
| Protein Sequence | SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assbly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Universal ribosomal protein uS15 family |
| Tissue Specificity | rpsO |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
