Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0A7S9 |
| Gene Names | rpsM |
| Alternative Names | rpsM; b3298; JW3260; 30S ribosomal protein S13; Small ribosomal subunit protein uS13 |
| Expression Region | Full Length of Mature Protein(2-118aa ) |
| Molecular Weight | 40 kDa |
| Protein Sequence | ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Universal ribosomal protein uS13 family |
| Tissue Specificity | rpsM |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |