Recombinant Epstein-Barr virus Latent membrane protein 2(LMP2),partial

Specification
Organism Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P13285
Gene Names LMP2
Alternative Names Terminal protein
Expression Region Partial(1-147aa )
Molecular Weight 17.6 kDa
Protein Sequence MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs. Isoform LMP2B may be a negative regulator of isoform LMP2A.
Involvement in Disease
Subcellular Location Isoform LMP2A: Host cell membrane, Multi-pass membrane protein, Note=Isoform LMP2A is localized in plasma membrane lipid rafts, SUBCELLULAR LOCATION: Isoform LMP2B: Host endomembrane system, Multi-pass membrane protein, Host cytoplasm, host perinuclear region
Protein Families Herpesviridae LMP-2 family
Tissue Specificity LMP2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYEFA321211

Recombinant Epstein-Barr virus Latent membrane protein 2(LMP2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Epstein-Barr virus Latent membrane protein 2(LMP2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.