Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3),partial

Specification
Organism Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P12977
Gene Names EBNA3
Alternative Names Epstein-Barr nuclear antigen 3A (EBNA-3A) (EBV nuclear antigen 3A)
Expression Region Partial(1-138aa )
Molecular Weight 22.2 kDa
Protein Sequence MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
Involvement in Disease
Subcellular Location Host nucleus matrix
Protein Families Herpesviridae EBNA-3 family
Tissue Specificity EBNA3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEEFA319157

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.