Specification
| Organism | Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q69022 |
| Gene Names | EBNA2 |
| Alternative Names | EBNA2; BYRF1Epstein-Barr nuclear antigen 2; EBNA-2; EBV nuclear antigen 2 |
| Expression Region | Partial(247-454aa ) |
| Molecular Weight | 25.9 kDa |
| Protein Sequence | SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Host nucleus matrix |
| Protein Families | Herpesviridae EBNA2 family |
| Tissue Specificity | EBNA2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |