Specification
| Organism | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P03198 |
| Gene Names | BALF5 |
| Alternative Names | BALF5DNA polymerase catalytic subunit; EC 2.7.7.7 |
| Expression Region | Partial(1-210aa ) |
| Molecular Weight | 39.2 kDa |
| Protein Sequence | MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein. |
| Involvement in Disease | |
| Subcellular Location | Host nucleus |
| Protein Families | DNA polymerase type-B family |
| Tissue Specificity | BALF5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |