Specification
| Organism | Enterovirus A71 |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | F6KTB0 |
| Gene Names | N/A |
| Alternative Names | VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A) (Protein 2A) (Protein 3B) (P3B) (3D polymerase) (3Dpol) (Protein 3D) |
| Expression Region | Partial(1441-1497aa ) |
| Molecular Weight | 19.4 kDa |
| Protein Sequence | GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Capsid protein VP0: Component of immature procapsids, which is cleaved into capsid proteins VP4 and VP2 after maturation. Allows the capsid to remain inactive before the maturation step. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |