Specification
| Organism | Enterobacteria phage M13 (Bacteriophage M13) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P69538 |
| Gene Names | IX |
| Alternative Names | Coat protein C, polypeptide II G9P |
| Expression Region | Full Length(1-32aa ) |
| Molecular Weight | 19.7 kDa |
| Protein Sequence | MSVLVYSFASFVLGWCLRSGITYFTRLMETSS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. |
| Involvement in Disease | |
| Subcellular Location | Virion, Host membrane, Single-pass membrane protein |
| Protein Families | Inovirus G9P protein family |
| Tissue Specificity | IX |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |