Specification
Organism | Enterobacteria phage H19B (Bacteriophage H19B) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P69179 |
Gene Names | stxB |
Alternative Names | Verocytotoxin 1 subunit B ;Verotoxin 1 subunit B |
Expression Region | Full Length of Mature Protein(21-89aa ) |
Molecular Weight | 9.7 kDa |
Protein Sequence | TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | StxB family |
Tissue Specificity | stxB |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |