Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

Specification
Organism Enterobacteria phage 933W (Bacteriophage 933W)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P09386
Gene Names stxB2
Alternative Names Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B
Expression Region Full Length of Mature Protein(20-89aa )
Molecular Weight 9.8 kDa
Protein Sequence ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Involvement in Disease
Subcellular Location Secreted
Protein Families StxB family
Tissue Specificity stxB2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYECC357788

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)
Copyright © 2026-present Echo Bio. All rights reserved.