Specification
| Organism | Echis carinatus (Saw-scaled viper) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P81631 |
| Gene Names | N/A |
| Alternative Names | Disintegrin EC3B |
| Expression Region | Full Length(1-67aa ) |
| Molecular Weight | 23.4 kDa |
| Protein Sequence | NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1). It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Venom metalloproteinase (M12B) family, P-II subfamily, P-IIe sub-subfamily |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |