Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA(UbcD6)

Specification
Organism Drosophila melanogaster (Fruit fly)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P25153
Gene Names UbcD6
Alternative Names Ubiquitin carrier proteinUbiquitin-protein ligase
Expression Region Full Length(1-151aa )
Molecular Weight 19.2 kDa
Protein Sequence MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.
Involvement in Disease
Subcellular Location Nucleus
Protein Families Ubiquitin-conjugating enzyme family
Tissue Specificity UbcD6
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYDLU328642

Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA(UbcD6)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA(UbcD6)
Copyright © 2021-present Echo Biosystems. All rights reserved.