Recombinant Drosophila melanogaster GEO11329p1(ITP)

Specification
Organism Drosophila melanogaster (Fruit fly)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9W151
Gene Names ITP
Alternative Names /
Expression Region Full Length of Mature Protein(33-119aa )
Molecular Weight 38
Protein Sequence SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQHFLRVVNGSPISFNMGPQT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ITP
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMDLU3475

Recombinant Drosophila melanogaster GEO11329p1(ITP)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Drosophila melanogaster GEO11329p1(ITP)
Copyright © 2021-present Echo Biosystems. All rights reserved.