Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)

Specification
Organism Drosophila melanogaster (Fruit fly)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q06559
Gene Names RpS3
Alternative Names M(3)95A
Expression Region Full Length(1-246aa )
Molecular Weight 31.5 kDa
Protein Sequence MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.
Involvement in Disease
Subcellular Location Cytoplasm, Nucleus
Protein Families Universal ribosomal protein uS3 family
Tissue Specificity RpS3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PEDLU20568

Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)
Copyright © 2026-present Echo Bio. All rights reserved.