Specification
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O97758 |
| Gene Names | TJP1 |
| Alternative Names | Tight junction protein 1Zona occludens protein 1Zonula occludens protein 1 |
| Expression Region | Partial(1633-1769aa ) |
| Molecular Weight | 18.7 kDa |
| Protein Sequence | VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells . |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell junction, tight junction, Cell junction, Cell junction, gap junction |
| Protein Families | MAGUK family |
| Tissue Specificity | TJP1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |