Recombinant Dog Osteocalcin(BGLAP)

Specification
Organism Canis lupus familiaris (Dog) (Canis familiaris)
Expression Host E.coli
Tag Info N-terminal 6xHis-KSI-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P81455
Gene Names BGLAP
Alternative Names Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)
Expression Region Full Length(1-49aa )
Molecular Weight 20.9 kDa
Protein Sequence YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity BGLAP
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE2DO2807

Recombinant Dog Osteocalcin(BGLAP)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dog Osteocalcin(BGLAP)
Copyright © 2021-present Echo Biosystems. All rights reserved.