Recombinant Dog Lutropin subunit beta(LHB)

Specification
Organism Canis lupus familiaris (Dog) (Canis familiaris)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P18842
Gene Names LHB
Alternative Names Luteinizing hormone subunit beta Short name:LH-B Short name:LSH-B Short name:LSH-beta
Expression Region Full Length of Mature Protein(18-138aa )
Molecular Weight 16.8 kDa
Protein Sequence SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
Involvement in Disease
Subcellular Location Secreted
Protein Families Glycoprotein hormones subunit beta family
Tissue Specificity LHB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE0DO13035

Recombinant Dog Lutropin subunit beta(LHB)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dog Lutropin subunit beta(LHB)
Copyright © 2021-present Echo Biosystems. All rights reserved.