Specification
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P41324 |
| Gene Names | IL8 |
| Alternative Names | C-X-C motif chemokine hemokine (C-X-C motif) ligand 8 |
| Expression Region | Full Length of Mature Protein(23-101aa ) |
| Molecular Weight | 36.1 kDa |
| Protein Sequence | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | IL8 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
