Specification
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O77762 |
| Gene Names | L4 |
| Alternative Names | B-cell stimulatory factor 1 ;BSF-1Lymphocyte stimulatory factor 1 |
| Expression Region | Full Length of Mature Protein(25-132aa ) |
| Molecular Weight | 16.8 kDa |
| Protein Sequence | HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes . |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-4/IL-13 family |
| Tissue Specificity | L4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |