Specification
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P35834 |
| Gene Names | CSF3 |
| Alternative Names | Short name: G-CSF |
| Expression Region | Full Length(1-175aa ) |
| Molecular Weight | 34.9 kDa |
| Protein Sequence | MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-6 superfamily |
| Tissue Specificity | CSF3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |