Recombinant Dog Glycoprotein hormones alpha chain(CGA)

Specification
Organism Canis familiaris (Dog) (Canis lupus familiaris)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9XSW8
Gene Names CGA
Alternative Names Anterior pituitary glycoprotein hormones common subunit alpha;Follicle-stimulating hormone alpha chain;FSH-alpha;Follitropin alpha chain;Luteinizing hormone alpha chain;LSH-alpha;Lutropin alpha chain;Thyroid-stimulating hormone alpha chain;TSH-alpha;Thyrotropin alpha chain
Expression Region Full Length of Mature Protein(25-120aa )
Molecular Weight 18.1 kDa
Protein Sequence FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity CGA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE4DO895599

Recombinant Dog Glycoprotein hormones alpha chain(CGA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dog Glycoprotein hormones alpha chain(CGA)
Copyright © 2021-present Echo Biosystems. All rights reserved.