Specification
Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P21842 |
Gene Names | CMA1 |
Alternative Names | Alpha-chymase;Mast cell protease I |
Expression Region | Full Length of Mature Protein(22-249aa ) |
Molecular Weight | 27.5 kDa |
Protein Sequence | IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion. |
Involvement in Disease | |
Subcellular Location | Secreted, Cytoplasmic granule |
Protein Families | Peptidase S1 family, Granzyme subfamily |
Tissue Specificity | CMA1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |