Specification
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P33724 |
| Gene Names | CAV1 |
| Alternative Names | Vesicular integral-membrane protein VIP21 |
| Expression Region | Full Length(1-178aa ) |
| Molecular Weight | 22.6 kDa |
| Protein Sequence | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar mbranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Recruits CTNNB1 to caveolar mbranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. |
| Involvement in Disease | |
| Subcellular Location | Golgi apparatus membrane, Peripheral membrane protein, Cell membrane, Peripheral membrane protein, Membrane, caveola, Peripheral membrane protein, Membrane raft, Golgi apparatus, trans-Golgi network |
| Protein Families | Caveolin family |
| Tissue Specificity | CAV1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |