Recombinant Dog Anionic trypsin

Specification
Organism Canis lupus familiaris (Dog) (Canis familiaris)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06872
Gene Names N/A
Alternative Names ; Anionic trypsin; EC 3.4.21.4
Expression Region Full Length of Mature Protein(24-247aa )
Molecular Weight 40 kDa
Protein Sequence IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Secreted, extracellular space
Protein Families Peptidase S1 family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PC4DO357079

Recombinant Dog Anionic trypsin

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dog Anionic trypsin
Copyright © 2021-present Echo Biosystems. All rights reserved.