Recombinant Dictyostelium discoideum Ponticulin(ponA)

Specification
Organism Dictyostelium discoideum (Slime mold)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P54660
Gene Names ponA
Alternative Names ponA; DDB_G0293522; Ponticulin
Expression Region Full Length of Mature Protein(23-118aa )
Molecular Weight 13.9 kDa
Protein Sequence QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Ponticulin family
Tissue Specificity ponA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDKK345918

Recombinant Dictyostelium discoideum Ponticulin(ponA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dictyostelium discoideum Ponticulin(ponA)
Copyright © 2021-present Echo Biosystems. All rights reserved.