Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2(DERF2)

Specification
Organism Dermatophagoides farinae (American house dust mite)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q00855
Gene Names DERF2
Alternative Names Allergen Der f II Allergen: Der f 2
Expression Region Full Length of Mature Protein(18-146aa )
Molecular Weight 16.1 kDa
Protein Sequence DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Secreted
Protein Families NPC2 family
Tissue Specificity DERF2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYDCO312547

Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2(DERF2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2(DERF2)
Copyright © 2021-present Echo Biosystems. All rights reserved.