Specification
| Organism | Dendroaspis polylepis polylepis (Black mamba) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25687 |
| Gene Names | N/A |
| Alternative Names | Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A |
| Expression Region | Full Length(1-81aa ) |
| Molecular Weight | 24.6 kDa |
| Protein Sequence | AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | AVIT (prokineticin) family |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |