Specification
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Expression Host | Yeast |
| Tag Info | C-terminal 6xHis-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | B0UZC8 |
| Gene Names | vwc2l |
| Alternative Names | vwc2l; si:ch211-207d8.1; von Willebrand factor C domain-containing protein 2-like |
| Expression Region | Full Length of Mature Protein(22-223aa ) |
| Molecular Weight | 25.4 kDa |
| Protein Sequence | ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in bone differentiation and matrix mineralization. May play a role in neural development. |
| Involvement in Disease | |
| Subcellular Location | Secreted, Cell junction, synapse |
| Protein Families | |
| Tissue Specificity | vwc2l |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |