Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like(vwc2l)

Specification
Organism Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Host Yeast
Tag Info C-terminal 6xHis-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID B0UZC8
Gene Names vwc2l
Alternative Names vwc2l; si:ch211-207d8.1; von Willebrand factor C domain-containing protein 2-like
Expression Region Full Length of Mature Protein(22-223aa )
Molecular Weight 25.4 kDa
Protein Sequence ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May play a role in bone differentiation and matrix mineralization. May play a role in neural development.
Involvement in Disease
Subcellular Location Secreted, Cell junction, synapse
Protein Families
Tissue Specificity vwc2l
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYLf35317888

Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like(vwc2l)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like(vwc2l)
Copyright © 2021-present Echo Biosystems. All rights reserved.