Recombinant Danio rerio Metallothionein-1(mt)

Specification
Organism Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P52722
Gene Names mt
Alternative Names mt; mt1; Metallothionein-1; MT-1
Expression Region Full Length(1-60aa )
Molecular Weight 22 kDa
Protein Sequence MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Involvement in Disease
Subcellular Location
Protein Families Metallothionein superfamily, Type 1 family
Tissue Specificity mt
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDIL344946

Recombinant Danio rerio Metallothionein-1(mt)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Danio rerio Metallothionein-1(mt)
Copyright © 2021-present Echo Biosystems. All rights reserved.