Recombinant Danio rerio Fin bud initiation factor(fibin)

Specification
Organism Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A1IGX5
Gene Names fibin
Alternative Names /
Expression Region Full Length of Mature Protein(24-210aa )
Molecular Weight 25.8 kDa
Protein Sequence FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Essential for the initiation of pectoral fin bud formation. Potentially acts downstream of retinoic acid and Wnt signaling and is required for tbx5 expression in the lateral plate mesoderm of presumptive pectoral fin bud regions.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity fibin
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PBDIL375642

Recombinant Danio rerio Fin bud initiation factor(fibin)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Danio rerio Fin bud initiation factor(fibin)
Copyright © 2021-present Echo Biosystems. All rights reserved.