Specification
| Organism | Dahlia merckii (Bedding dahlia) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0C8Y4 |
| Gene Names | N/A |
| Alternative Names | Cysteine-rich antimicrobial protein 1 Defensin AMP1 |
| Expression Region | Full Length(1-50aa ) |
| Molecular Weight | 19.5 kDa |
| Protein Sequence | ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | DEFL family |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |