Specification
Organism | Dactylis glomerata (Orchard grass) (Cock's-foot grass) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P93124 |
Gene Names | N/A |
Alternative Names | Allergen Dac g III Allergen: Dac g 3 |
Expression Region | Full Length(1-96aa ) |
Molecular Weight | 12.9 kDa |
Protein Sequence | VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | Expansin family, Expansin B subfamily |
Tissue Specificity | N/A |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |