Recombinant Culex quinquefasciatus Submitted name: Odorant binding protein OBP28(6050687)

Specification
Organism Culex quinquefasciatus (Southern house mosquito) (Culex pungens)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID B0XC79
Gene Names 6050687
Alternative Names /
Expression Region Full Length of Mature Protein(21-150aa )
Molecular Weight 18.6 kDa
Protein Sequence DEASDKEQAKEQAKQMLRSMTQKCKEAEGASDDDVEAMIDDVMPESQVQKCFHSCVQQQFGVSDGQKFLQQGFLEIMMMAVGNDEQQQGHAKEVAEECDGVANEDRCQLAVDIMTCVKQGMEKRGMKVDR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity 6050687
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PBDZM3268

Recombinant Culex quinquefasciatus Submitted name: Odorant binding protein OBP28(6050687)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Culex quinquefasciatus Submitted name: Odorant binding protein OBP28(6050687)
Copyright © 2026-present Echo Bio. All rights reserved.