Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2

Specification
Organism Crotalus adamanteus (Eastern diamondback rattlesnake)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P34179
Gene Names N/A
Alternative Names Adamalysin II Proteinase II
Expression Region Full Length(1-203aa )
Molecular Weight 27.1 kDa
Protein Sequence QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.
Involvement in Disease
Subcellular Location Secreted
Protein Families Venom metalloproteinase (M12B) family, P-I subfamily
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDYB330450

Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2
Copyright © 2021-present Echo Biosystems. All rights reserved.