Recombinant Coxiella burnetii Protein RnfH(rnfH)

Specification
Organism Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212))
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID B6IZH9
Gene Names rnfH
Alternative Names rnfH; CbuG_0706; Protein RnfH
Expression Region Full Length(1-101aa )
Molecular Weight 27.3 kDa
Protein Sequence MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location
Protein Families UPF0125 (RnfH) family
Tissue Specificity rnfH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDXM481685

Recombinant Coxiella burnetii Protein RnfH(rnfH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Coxiella burnetii Protein RnfH(rnfH)
Copyright © 2021-present Echo Biosystems. All rights reserved.