Recombinant Colwellia psychrerythraea DNA polymerase IV(dinB)

Specification
Organism Colwellia psychrerythraea (strain 34H / ATCC BAA-681)(Vibrio psychroerythus)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q487H6
Gene Names dinB
Alternative Names dinB; CPS_1040DNA polymerase IV; Pol IV; EC 2.7.7.7
Expression Region Full Length(1-352aa )
Molecular Weight 39.3 kDa
Protein Sequence MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families DNA polymerase type-Y family
Tissue Specificity dinB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PEBe16764136

Recombinant Colwellia psychrerythraea DNA polymerase IV(dinB)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Colwellia psychrerythraea DNA polymerase IV(dinB)
Copyright © 2021-present Echo Biosystems. All rights reserved.