Specification
| Organism | Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A5I6G4 |
| Gene Names | pbpA |
| Alternative Names | Peptidoglycan TGase DD-transpeptidase |
| Expression Region | Partial(663-830aa ) |
| Molecular Weight | 35.2 kDa |
| Protein Sequence | VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type II membrane protein |
| Protein Families | Glycosyltransferase 51 family; Transpeptidase family |
| Tissue Specificity | pbpA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |