Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B(ctfB)

Specification
Organism Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P23673
Gene Names ctfB
Alternative Names Acetoacetyl-CoA:acetate/butyrate CoA-transferase subunit B (Coat B)
Expression Region Full Length(1-221aa )
Molecular Weight 30.6 kDa
Protein Sequence MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Involvement in Disease
Subcellular Location
Protein Families 3-oxoacid CoA-transferase subunit B family
Tissue Specificity ctfB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDUB333056

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B(ctfB)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit B(ctfB)
Copyright © 2021-present Echo Biosystems. All rights reserved.