Recombinant Chlorobium tepidum Polyphosphate kinase 2(ppk2),partial

Specification
Organism Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O68984
Gene Names ppk2
Alternative Names ATP-polyphosphate phosphotransferase 2 Polyphosphoric acid kinase 2
Expression Region Partial(140-343aa )
Molecular Weight 34.4 kDa
Protein Sequence EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP).
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ppk2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEDST525637

Recombinant Chlorobium tepidum Polyphosphate kinase 2(ppk2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Chlorobium tepidum Polyphosphate kinase 2(ppk2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.