Specification
| Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0CC05 |
| Gene Names | omcA |
| Alternative Names | 9KDA cysteine-rich lipoprotein Short name:9KDA-CRP |
| Expression Region | Full Length of Mature Protein(19-88aa ) |
| Molecular Weight | 23.4 kDa |
| Protein Sequence | CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane, Lipid-anchor |
| Protein Families | |
| Tissue Specificity | omcA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |